r 2015 b Search Results


96
MathWorks Inc image processing toolbox
Image Processing Toolbox, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2015+b/10__3390_slash_rs9090961-126-13-19?v=MathWorks+Inc
Average 96 stars, based on 1 article reviews
image processing toolbox - by Bioz Stars, 2026-07
96/100 stars
  Buy from Supplier

99
STATA Corporation r software package rdrobust
R Software Package Rdrobust, supplied by STATA Corporation, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2015+b/10__1177_slash_1536867x1701700208-9-12-41?v=STATA+Corporation
Average 99 stars, based on 1 article reviews
r software package rdrobust - by Bioz Stars, 2026-07
99/100 stars
  Buy from Supplier

90
Schwarzer GmbH zhou, g., zhang, l., knoll, n., & schwarzer, r
Zhou, G., Zhang, L., Knoll, N., & Schwarzer, R, supplied by Schwarzer GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2015+b/napolova_ekaterina__2020__making_the_world_a_better_place_the_use_of_marketing_for_a_positive_change-697-8-7?v=Schwarzer+GmbH
Average 90 stars, based on 1 article reviews
zhou, g., zhang, l., knoll, n., & schwarzer, r - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

96
MathWorks Inc matlab r 2015 b
Matlab R 2015 B, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2015+b/pmc11301250-138-13-17?v=MathWorks+Inc
Average 96 stars, based on 1 article reviews
matlab r 2015 b - by Bioz Stars, 2026-07
96/100 stars
  Buy from Supplier

86
Abbott Laboratories advanced ligo virgo network
Advanced Ligo Virgo Network, supplied by Abbott Laboratories, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2015+b/arxiv__2201__03458-4-8-17?v=Abbott+Laboratories
Average 86 stars, based on 1 article reviews
advanced ligo virgo network - by Bioz Stars, 2026-07
86/100 stars
  Buy from Supplier

N/A
Recombinant human ENO3 protein (His tag)
  Buy from Supplier

N/A
The ADAM10 Antibody (RM0146-7H12) [Biotin] from Novus is a ADAM10 antibody to ADAM10. This antibody reacts with Mouse. The ADAM10 antibody has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence,
  Buy from Supplier

N/A
Antibody clone RPA-T8 recognizes CD8a which is an isoform of CD8. CD8, also known as T8 and Leu2, is a type I membrane glycoprotein. CD8, is a member of the immunoglobulin superfamily found on the
  Buy from Supplier

N/A
Rabbit polyclonal TNFSF10 antibody (HRP)
  Buy from Supplier

N/A
Quantitative genomic RNA from Influenza B virus strain B/Florida/78/2015 can be used for assay development, verification, and validation as well as monitoring of day-to-day test variation and lot-to-lot performance of molecular-based assays. The quantitative format
  Buy from Supplier

N/A
The IgG Fc Antibody (RMG02) [Biotin] from Novus is a IgG Fc antibody to IgG Fc. This antibody reacts with Rabbit. The IgG Fc antibody has been validated for the following applications: Western Blot, ELISA.
  Buy from Supplier

N/A
SULT1C4 antibody was raised using the middle region of SULT1C4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK. Rabbit polyclonal SULT1C4 antibody raised against the middle region of SULT1C4.
  Buy from Supplier

Image Search Results